![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MDP0000836661 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 151aa MW: 17147.3 Da PI: 10.0109 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 101.6 | 4.5e-32 | 68 | 126 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+++fprsYY+Ct++gC+vkk+++r ++d+ +v++tY g H+h+ MDP0000836661 68 LDDGYRWRKYGQKVVKNNKFPRSYYKCTHQGCMVKKQIQRLSKDEGIVVTTYDGIHTHR 126 59********************************************************6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.5E-33 | 53 | 126 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.09E-29 | 60 | 127 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.988 | 63 | 128 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.7E-37 | 68 | 127 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.3E-25 | 69 | 126 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
MDHNNQIFFL GSSASSSASP VFSSSQSSFP LCLGDRNAGM MKSGRKEGDK VNKKQKYAFQ 60 TRSQVDILDD GYRWRKYGQK VVKNNKFPRS YYKCTHQGCM VKKQIQRLSK DEGIVVTTYD 120 GIHTHRIDEY SAENLEQIIR HMQASTVPNN * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-28 | 58 | 127 | 7 | 76 | Probable WRKY transcription factor 4 |
2lex_A | 1e-28 | 58 | 127 | 7 | 76 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008346674.1 | 1e-111 | PREDICTED: probable WRKY transcription factor 75 | ||||
Refseq | XP_008374228.1 | 1e-111 | PREDICTED: probable WRKY transcription factor 75 | ||||
Swissprot | Q9FYA2 | 2e-44 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
TrEMBL | M5WAY9 | 2e-55 | M5WAY9_PRUPE; Uncharacterized protein | ||||
STRING | Si026859m | 3e-50 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1156 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13080.1 | 3e-45 | WRKY DNA-binding protein 75 |
Link Out ? help Back to Top | |
---|---|
Phytozome | MDP0000836661 |